[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56332.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
c.37.1
:297 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   15->61 1e2jB PDBj 1e-04 25.5 %
:RPS:SCOP  15->45 1lw7A2  c.37.1.1 * 2e-04 25.8 %
:RPS:SCOP  16->68 1do0A  c.37.1.20 * 4e-04 26.4 %
:HMM:SCOP  13->183 1k6mA1 c.37.1.7 * 1.5e-08 28.7 %
:RPS:PFM   18->38 PF03215 * Rad17 6e-04 76.2 %
:HMM:PFM   17->59 PF00004 * AAA 1.2e-05 42.9 42/130  
:BLT:SWISS 20->63 GVPN_ANCAQ 5e-04 43.2 %
:BLT:SWISS 157->269 SYL_VIBCH 5e-04 34.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56332.1 GT:GENE BAD56332.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1659228..1660121 GB:FROM 1659228 GB:TO 1660121 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56332.1 LENGTH 297 SQ:AASEQ MMEFEEATKEAAKARIALTGPAGSGKTYTALMLAFELGENVAVIDTERGSASKYVGRNGWRFKTLKPTSFAPLSLVDHLAKAAGAGFDVVVVDSLSHYWEGTDGMLEQVDRRSGASKFTSGWKVVRPEERKMVDALLAYPGHVIVTLRAKQEYVLETNERGKQEPKRVGMKPIQREGIEYEFDLVGDLDLSNTLTVSKSRIEGVDMGSTYPKPGADIAAKVAEFLADGQQIPTVGEYRERVLAVESAEELRELWREVRAHQLDGAPMLDEHGHPTVLGDFISYRGTQLKMRKSEAGS GT:EXON 1|1-297:0| BL:SWS:NREP 2 BL:SWS:REP 20->63|GVPN_ANCAQ|5e-04|43.2|44/357| BL:SWS:REP 157->269|SYL_VIBCH|5e-04|34.3|108/858| SEG 3->14|efeeatkeaaka| SEG 80->93|akaagagfdvvvvd| RP:PDB:NREP 1 RP:PDB:REP 15->61|1e2jB|1e-04|25.5|47/314| RP:PFM:NREP 1 RP:PFM:REP 18->38|PF03215|6e-04|76.2|21/379|Rad17| HM:PFM:NREP 1 HM:PFM:REP 17->59|PF00004|1.2e-05|42.9|42/130|AAA| GO:PFM:NREP 3 GO:PFM GO:0005634|"GO:nucleus"|PF03215|IPR004582| GO:PFM GO:0006281|"GO:DNA repair"|PF03215|IPR004582| GO:PFM GO:0007049|"GO:cell cycle"|PF03215|IPR004582| RP:SCP:NREP 2 RP:SCP:REP 15->45|1lw7A2|2e-04|25.8|31/181|c.37.1.1| RP:SCP:REP 16->68|1do0A|4e-04|26.4|53/406|c.37.1.20| HM:SCP:REP 13->183|1k6mA1|1.5e-08|28.7|136/0|c.37.1.7|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-----------------------------------------------------------------------------------------------------------1----------------------------------------------------------------1-11--------------------------------------------1-----------------------------------------------------------------------------------------------------1------------------------------------------------1------1-------------------------------------------1--------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------1--------------------------------1--------------------------------------------------------1-------------------------- STR:NPRED 47 STR:RPRED 15.8 SQ:SECSTR ##############EEEEcccTTccHHHHHHHHHHHccTTccEEEcccHHHHHTTccccHH############################################################################################################################################################################################################################################ DISOP:02AL 1-10, 289-297| PSIPRED cccccHHHHHHHHHHHEEEccccccHHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHHccccccccHHHHHHHHHHHccccEEEEEcccHHHHccccHHHHHHHHHHccccccccHHEEcHHHHHHHHHHHHcccEEEEEEEccEEEEEEccccHHHHHHHHccccEEcccccEEEEEEEEccccccEEEEEcccccccccEEEEcccHHHHHHHHHHHHccHHcHHHHHHHHHHHccHHHHHHHHHHHHHHccEEEcccccccccccHHHHHHHHHHHHHHHHHHHcccc //