[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56333.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   33->81 1bxiB PDBj 1e-06 25.0 %
:RPS:PFM   34->80 PF01844 * HNH 2e-04 50.0 %
:HMM:PFM   33->81 PF01844 * HNH 8.1e-12 36.4 44/52  
:BLT:SWISS 21->89 MCRA_ECOLI 1e-04 38.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56333.1 GT:GENE BAD56333.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1660118..1660510 GB:FROM 1660118 GB:TO 1660510 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56333.1 LENGTH 130 SQ:AASEQ MSTWPKSRPRSPRRRYTGATPAVLMLVKSRAGGRCERCAAPIPTTAEVHHRIPRGMGGTRDPRVNRPSALVVLCPQCHRRIESYREKARLDGWLVRRTSNPAEVAIESRLHGRVLLADDGSVVSVGGDAA GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 21->89|MCRA_ECOLI|1e-04|38.1|63/277| SEG 7->15|srprsprrr| RP:PDB:NREP 1 RP:PDB:REP 33->81|1bxiB|1e-06|25.0|44/129| RP:PFM:NREP 1 RP:PFM:REP 34->80|PF01844|2e-04|50.0|42/49|HNH| HM:PFM:NREP 1 HM:PFM:REP 33->81|PF01844|8.1e-12|36.4|44/52|HNH| GO:PFM:NREP 2 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01844|IPR002711| GO:PFM GO:0004519|"GO:endonuclease activity"|PF01844|IPR002711| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------1-1--------------------------------------------------------------------------------- STR:NPRED 52 STR:RPRED 40.0 SQ:SECSTR ##########################HHTTccTccccccGGGccccEEEEcccTTTTcc###cccccGGEEEEcHHHHHHc################################################# DISOP:02AL 1-16, 50-63, 128-130| PSIPRED ccccccccccccccccccccHHHHHHHHHHcccEEEEccccccccccccEEEcccccccccccHHHHHHHHHcccccccHHHccHHHHHHcccEEcccccccEEEEEEEcccEEEEcccccEEEcccccc //