[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56334.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:250 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  2->153 1cexA_ c.69.1.30 * 1.2e-10 29.1 %
:HMM:PFM   36->119 PF08237 * PE-PPE 6.1e-09 37.0 81/225  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56334.1 GT:GENE BAD56334.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1660507..1661259 GB:FROM 1660507 GB:TO 1661259 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56334.1 LENGTH 250 SQ:AASEQ MTVDVIWLGGTGFPRGGDGVSETFASALDRDRFRFRIVSYPATFGGTGLAWAESREAGRSALIDAMCATENRVVIGGYSQGAGIAGGLAAEIGRGELTGLRRQLLACALIADPERPRGAGMPGRPAAPGYGIVGERPVHGLPAFWAAAERDPITALPAGSPLRTLPDILDYYSIRSPAAARAWGEALIQRARQNRFQRWWDLRLVLEWGGAVRQALDYLPSPPGGGRHGQAYVIEGLATALAHVINEEVR GT:EXON 1|1-250:0| SEG 75->97|iggysqgagiagglaaeigrgel| SEG 113->131|perprgagmpgrpaapgyg| HM:PFM:NREP 1 HM:PFM:REP 36->119|PF08237|6.1e-09|37.0|81/225|PE-PPE| HM:SCP:REP 2->153|1cexA_|1.2e-10|29.1|134/0|c.69.1.30|1/1|alpha/beta-Hydrolases| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 117-128, 248-250| PSIPRED cEEEEEEEcccccccccccccHHHHHHccccEEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHccccccccHHHEEEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccc //