[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56337.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   65->98 PF04539 * Sigma70_r3 1.9e-06 32.4 34/78  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56337.1 GT:GENE BAD56337.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1662547..1662870 GB:FROM 1662547 GB:TO 1662870 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56337.1 LENGTH 107 SQ:AASEQ MNARRNPVPPESIRDAAALMLAIVTSDHNGVDAILDHCDTDGYFAILPEWVIGADISDRAFRLYAAMQIDQSHGRRSTKADLAARLHISIDRLDEALRELATVGGVA GT:EXON 1|1-107:0| HM:PFM:NREP 1 HM:PFM:REP 65->98|PF04539|1.9e-06|32.4|34/78|Sigma70_r3| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 72-77| PSIPRED ccccccccccHHHHHHHHHHHHHHccccccHHHHHHHcccccEEEEcccHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccc //