[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56338.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
a.4.5
:267 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->91 2e1nB PDBj 5e-06 13.8 %
:RPS:PDB   103->208 3c2pA PDBj 7e-04 10.7 %
:RPS:SCOP  20->91 2co5A1  a.4.5.48 * 3e-04 12.7 %
:HMM:PFM   41->70 PF01047 * MarR 0.0001 36.7 30/59  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56338.1 GT:GENE BAD56338.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1662867..1663670 GB:FROM 1662867 GB:TO 1663670 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56338.1 LENGTH 267 SQ:AASEQ MSIRAISWVLYQAEVDDHGDFRLLVALADRASDDGTGAFPSVDFLAKRMRRTPRSVQRGLRKLMEDGWIRLGDQQLVAHYRADRRPTVYDLVMDRTRGDADVTPPLNGATPSVTPPNSNEATSYVTPLHPHEVTPDVTPHPARGDIHGTHGVTSDVTQTVPSLLRNETVQESGAPSALGTPDDDEPKRKRPAIRLPADWAPTDAHRESALNAGVDVAVEAYKFRLHAAEQDRRCVSWNAAFSRWLMNARPTRPVTSGVSESGRLWQD GT:EXON 1|1-267:0| RP:PDB:NREP 2 RP:PDB:REP 1->91|2e1nB|5e-06|13.8|87/112| RP:PDB:REP 103->208|3c2pA|7e-04|10.7|103/1093| HM:PFM:NREP 1 HM:PFM:REP 41->70|PF01047|0.0001|36.7|30/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 20->91|2co5A1|3e-04|12.7|63/89|a.4.5.48| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- -----1------------------------------1-------1------------------------------111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------------- STR:NPRED 193 STR:RPRED 72.3 SQ:SECSTR ccHHHHHHHHHccccEEccHHHHHHHHTTccEEHHHHHcHHHHHHcTTEEccHHHHHHHHHHHHHTTcEEEEEEcEE#cTTccccEEEEEE###########ccTTcTTccccHHHHHHHHHHHHcccEEc###HHHHHHHHHHcHHHHHHHHccccccTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccGGGccEEccE########################################################### DISOP:02AL 78-80, 101-155, 167-187, 254-255, 262-263, 266-267| PSIPRED cHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccEEcHHHHHHHHHHcccHHHHHHHHHHHHHcccEEccHHHHHHcccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccHHHcccccccccHHHccccccHHHHHHccHHHHHHHHHHHccccccHHcEEHHHHHHHHHHHHcccccccccccccccccccc //