[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56341.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   57->115 PF05130 * FlgN 0.0001 28.6 56/143  
:BLT:SWISS 54->125 CAR14_HUMAN 7e-06 37.5 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56341.1 GT:GENE BAD56341.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1665378..1665764 GB:FROM 1665378 GB:TO 1665764 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56341.1 LENGTH 128 SQ:AASEQ MPENPPRLTAEELESLREATLQRYVAADHTYAEIGRLRAYTDEPDGGLINLIDMASSLARSHEAALERIAELEGERARLVEGVASTVRRFSATLGERDALRARVAELEDQIAWLRAEFTDLPECPKES GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 54->125|CAR14_HUMAN|7e-06|37.5|72/1004| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 54->81| HM:PFM:NREP 1 HM:PFM:REP 57->115|PF05130|0.0001|28.6|56/143|FlgN| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 126-128| PSIPRED cccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //