[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56344.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56344.1 GT:GENE BAD56344.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1667292..1667687 GB:FROM 1667292 GB:TO 1667687 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56344.1 LENGTH 131 SQ:AASEQ MKIRQLTAEGRRLYARLYAAVLDSGERRVVLSSEGDTAPTTDLLVWAGNNLPVLLDALDEAEEARARAAEAKRPTLGYAAVDLRACDRRPQPVLLGPWDDEKSVREAWGDTEGVVLTELSVLPTEEGQADA GT:EXON 1|1-131:0| SEG 54->71|lldaldeaeeararaaea| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 65-70, 125-131| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccEEEEEEccccEEEEEHHHHHHHHHHHHHHcccccccEEEEEHHHHccccccEEEcccccHHHHHHHccccccEEEEEEEEcccccccccc //