[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56346.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.44
:200 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  34->87 1iwgA2  d.58.44.1 * 3e-04 7.5 %
:BLT:SWISS 6->56 DNLJ_RUBXD 6e-04 50.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56346.1 GT:GENE BAD56346.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1668285..1668887 GB:FROM 1668285 GB:TO 1668887 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56346.1 LENGTH 200 SQ:AASEQ MSNLIRRIDEIRRSRHPWYDWGHRVMILLGREDDGRFDNVPRVRDVWFRHENGRLVTTRDYAEVRARNDGEWKVFDSQNDGFEVVIGWWPDEHGPITRTGLNGRDEQRLFLRWFVWEGWIKAEWCGLRRRLYYRALHAAVHQKIPFACQQVPAPDSGGYSHWHCELRRKHDGPHRYRGCTWIDRGRVEFTPKAADREDRR GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 6->56|DNLJ_RUBXD|6e-04|50.0|44/100| SEG 127->139|lrrrlyyralhaa| RP:SCP:NREP 1 RP:SCP:REP 34->87|1iwgA2|3e-04|7.5|53/104|d.58.44.1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 192-200| PSIPRED ccHHHHHHHHHHHHcccccccccEEEEEEEccccccccccccHHHEEEEEccccEEEEccHHHHHccccccEEEEEcccccEEEEEEEcccccccEEEcccccccccEEEEEEEEccccEEHHHHHHHHHHHHHHHHHHHHHccccHHHcccccccccccEEEEEEEcccccccccccccEEEccEEEEccccccccccc //