[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56348.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->33 PF07026 * DUF1317 0.00029 26.3 19/60  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56348.1 GT:GENE BAD56348.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1669044..1669268 GB:FROM 1669044 GB:TO 1669268 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56348.1 LENGTH 74 SQ:AASEQ MPDRYSDPDPTTPVAQADCPYRCRPSGWLTPADADVMRPCPIHRPRRQPTGTTYDPTRISDRARAAIEADEENP GT:EXON 1|1-74:0| SEG 58->72|risdraraaieadee| HM:PFM:NREP 1 HM:PFM:REP 15->33|PF07026|0.00029|26.3|19/60|DUF1317| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 66-74| PSIPRED cccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccEEEccccccc //