Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56350.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:55 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56350.1 GT:GENE BAD56350.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1669522..1669689 GB:FROM 1669522 GB:TO 1669689 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56350.1 LENGTH 55 SQ:AASEQ MSFVVRSPSGRCVVSLPTGTAEEMREVAVELSDMLAVFAAAGAKPQLSVVREAGA GT:EXON 1|1-55:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 54-55| PSIPRED ccEEEEcccccEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccc //