[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56353.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->80 PF04300 * FBA 0.00079 32.2 59/184  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56353.1 GT:GENE BAD56353.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1670425..1670676 GB:FROM 1670425 GB:TO 1670676 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56353.1 LENGTH 83 SQ:AASEQ MTVYEDIKARIAADRAAAEQCPCDETLEGARAEIVGDFLEVAERWQLKAQEWGPEEQFVAYRDMVCQQILDLLSEGLWPEEAS GT:EXON 1|1-83:0| SEG 5->19|edikariaadraaae| HM:PFM:NREP 1 HM:PFM:REP 22->80|PF04300|0.00079|32.2|59/184|FBA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 80-83| PSIPRED cccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccc //