[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56356.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   78->209 3bloA PDBj 1e-04 18.0 %
:HMM:PFM   25->100 PF06390 * NESP55 4.4e-05 32.9 73/257  
:BLT:SWISS 77->108 MPP2_MOUSE 3e-04 56.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56356.1 GT:GENE BAD56356.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1672625..1673275 GB:FROM 1672625 GB:TO 1673275 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56356.1 LENGTH 216 SQ:AASEQ MSISPCTFPGCRDSAGDPALTSLGMCDPCQSQFSRLLGWLTMDWVNLTTTLPTPARRAQERVSRGRQVFGHPAEWASDTAAQIAAVLNETHDALADHLTETPPPHPGVGERYRVRAAWTYLECRIDRLAAAPFGGDVAVEMRDLHGQIRSRLGLTRPRQLLPTPCPSCELRTLFRSVDVGADSIDCGSCGHIIREEHYPFYTRMVLDTLLSSERAA GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 77->108|MPP2_MOUSE|3e-04|56.2|32/552| RP:PDB:NREP 1 RP:PDB:REP 78->209|3bloA|1e-04|18.0|128/349| HM:PFM:NREP 1 HM:PFM:REP 25->100|PF06390|4.4e-05|32.9|73/257|NESP55| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 59.3 SQ:SECSTR #############################################################################HHHHHHHHHHHHHHHTcHHHHHHcEEEccTTcHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHGGGccTTccEEE####TTcccHHHHHHHHTTTccEEEccccEEccTTccEETTcGGTTccc####### DISOP:02AL 1-3, 58-65, 214-216| PSIPRED ccccccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHEEccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHcccccccHHHHHHHHHHccccccccccccHHHHHHccccHHHHHHHHHHHHHcccc //