[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56357.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:83 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   25->81 3d6yA PDBj 2e-04 10.9 %
:RPS:SCOP  24->69 1j9iA  a.6.1.5 * 2e-05 23.9 %
:HMM:SCOP  23->77 1j9iA_ a.6.1.5 * 0.00013 27.8 %
:HMM:PFM   29->63 PF00376 * MerR 4.1e-06 17.1 35/38  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56357.1 GT:GENE BAD56357.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1673351..1673602 GB:FROM 1673351 GB:TO 1673602 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56357.1 LENGTH 83 SQ:AASEQ MEGVSSFPGGDMAAVLVTDGLDSKLTAVEASAIFSVTAATIRKWASLGKLAAVGMDARNRKLYRLADIAACEKATRHAAGRGR GT:EXON 1|1-83:0| RP:PDB:NREP 1 RP:PDB:REP 25->81|3d6yA|2e-04|10.9|55/277| HM:PFM:NREP 1 HM:PFM:REP 29->63|PF00376|4.1e-06|17.1|35/38|MerR| RP:SCP:NREP 1 RP:SCP:REP 24->69|1j9iA|2e-05|23.9|46/68|a.6.1.5| HM:SCP:REP 23->77|1j9iA_|0.00013|27.8|54/68|a.6.1.5|1/1|Putative DNA-binding domain| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 57 STR:RPRED 68.7 SQ:SECSTR ########################EEHHHHHHHHTccHHHHHHHHHTTcccccccEEcTTTccEEEcGGGGGHHHHHHHHH## DISOP:02AL 1-6, 77-83| PSIPRED cccccccccccEEEEEEEcccccEEEEEEHHHHccccHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHcccccc //