[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56358.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:84 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 5->83 YOR5_BPSPP 1e-12 48.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56358.1 GT:GENE BAD56358.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1673772..1674026 GB:FROM 1673772 GB:TO 1674026 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56358.1 LENGTH 84 SQ:AASEQ MPPQRYRKKPVEIEAMHFTDVSAGSRIAEWCGGTNVDSPHEIRIDTLEGTMTATLGDWVIRGVKGEFYPIKDEIFRATYEPVES GT:EXON 1|1-84:0| BL:SWS:NREP 1 BL:SWS:REP 5->83|YOR5_BPSPP|1e-12|48.1|79/100| OP:NHOMO 21 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ----------1-------------------------1---------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------1--------------------------------1--1111------1-------------------1----1---22------1------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------- DISOP:02AL 1-3, 83-84| PSIPRED ccccccccccEEEEEEEEcccccccHHHHHcccccccccccEEEEccccEEEEccccEEEEcccccEEEccHHHHHHHHHHHcc //