[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56359.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   87->101 PF01907 * Ribosomal_L37e 0.00035 40.0 15/55  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56359.1 GT:GENE BAD56359.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1674051..1674416 GB:FROM 1674051 GB:TO 1674416 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56359.1 LENGTH 121 SQ:AASEQ MPCAPLPRGLWSSRCSWRRCCPGSCGGPALMAEPHVDNTEHGHITWWKGFGPANYGPYTGTCPHHVDADSWLRPVAWGWDFKHYTLDQCQRCGARAWHDERIRPTTQWIASRPDLVGVSRA GT:EXON 1|1-121:0| HM:PFM:NREP 1 HM:PFM:REP 87->101|PF01907|0.00035|40.0|15/55|Ribosomal_L37e| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 120-121| PSIPRED ccccccccccHHcccccccccccccccccEEEcccccccccccEEEEccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccHHHHHHccccEEccccc //