[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56360.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   29->66 PF05977 * DUF894 0.00087 22.2 36/524  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56360.1 GT:GENE BAD56360.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1674409..1674621 GB:FROM 1674409 GB:TO 1674621 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56360.1 LENGTH 70 SQ:AASEQ MRKRLARALIRLAHRIYRPRVTVVDAADAPAWYRAVQEDLDRQDPWTRRLRTPEWADLLPPERRESRGWN GT:EXON 1|1-70:0| SEG 2->18|rkrlaralirlahriyr| HM:PFM:NREP 1 HM:PFM:REP 29->66|PF05977|0.00087|22.2|36/524|DUF894| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 62-70| PSIPRED cHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHcccccHHHHccccccccccccccccccccc //