[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56361.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->68 PF05630 * NPP1 0.00048 19.0 58/231  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56361.1 GT:GENE BAD56361.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1674731..1674973 GB:FROM 1674731 GB:TO 1674973 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56361.1 LENGTH 80 SQ:AASEQ MSVDVLVESESDVERIIDWVAQFEQINAYGSWDDGKKFERVTFCAESVEQYQRLVDYVASWDGEHGLGHDRLASPAMTKR GT:EXON 1|1-80:0| SEG 2->14|svdvlvesesdve| HM:PFM:NREP 1 HM:PFM:REP 10->68|PF05630|0.00048|19.0|58/231|NPP1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 77-80| PSIPRED cccEEEEcccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccccccc //