[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56367.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:333 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   151->223 PF01380 * SIS 0.0004 21.4 70/131  
:BLT:SWISS 32->329 VG13_BPMD2 9e-10 28.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56367.1 GT:GENE BAD56367.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1678745..1679746 GB:FROM 1678745 GB:TO 1679746 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56367.1 LENGTH 333 SQ:AASEQ MKRHCVIPDKQHRGEPFEWSDWQFWCAAKHYQVRAGIEWTGEPVFNQAFVYRRSQIVAPQKTGKGPWSASIVCLEAAGPSQFAGWADKGDGWACSEHGCGCGWEYEYLPGEPMADRHPSPVIQLTANNEDQVGNVYRPLAAMIKLGRLSDLMAVRENFIRILGSDGGEDFDRIDAVTSSARGRVGNPISFALQDESGLYTKRNKMVEIAEHQRRGAAGMNGRTMETTNAWDPAENSTAQRTYESQRPDIFKFFRIPPAGLSWGNRRDRRKILRYVYDGSPWVDLDSIEAEAMELNETDPAQAERFFGNRLVARSGSWLPQGLWESRYGDAVAS GT:EXON 1|1-333:0| BL:SWS:NREP 1 BL:SWS:REP 32->329|VG13_BPMD2|9e-10|28.8|267/595| HM:PFM:NREP 1 HM:PFM:REP 151->223|PF01380|0.0004|21.4|70/131|SIS| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------1-----------------------11------1------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------- DISOP:02AL 1-3| PSIPRED cccEEcccccccccccccccHHHHHHHHHHHHHcEEEEEEEEEEccccEEEEEEEEEEcccccccHHHHHHHHHHHHccHHHccccccccccccccccccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHcccccHHHHcccEEEEEEEEcccccccHHHHHcccccccccccccEEEEEcccccccccHHHHHHHHHHHHccccccccEEEEcccccccccHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHEEccccccccHHHHHHHHHHHccc //