[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56369.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
:482 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   89->410 PF05133 * Phage_prot_Gp6 4e-11 28.2 %
:HMM:PFM   19->445 PF05133 * Phage_prot_Gp6 5.1e-74 25.4 413/442  
:BLT:SWISS 38->428 VG14_BPMD2 3e-42 32.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56369.1 GT:GENE BAD56369.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1680331..1681779 GB:FROM 1680331 GB:TO 1681779 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56369.1 LENGTH 482 SQ:AASEQ MSVAIVLRTKLSDDERDMVNKLTGQLGRLSYKDRLYDAYYEGTQKLDHIGLAVPEELRIFELVANWPRMYLDEVSRRQKVKSIYRPGVDTADAALQEAFEANNLEAEVPILAKENMIFGRCFVSVGTNEDDKDHPLITVESPRQMSCLVNQRKRRMDAALRRYREQDGTQVATLFLPDRTIQLVASSNGWDIDVVGDDNGIDEHGLGRVPVVLFLNRRRLGSWTGTTEMADVIPLTDACARALTDLQYGVETVAVPKRYAIGVSKGDFVDKDGKPLPVWKAYFDALWATQKSSKDVTIGQLPGADLAGFHNTVKLYAELASSVTGLPFRYFGANTANPAAEGAIRADESRIVSNAEEKNAHLGVGLGWVLALYERFRTGNFPPAGEPIAVEWRNPATPTRAEEADAIQKLNGGNPVLSREGSWDEMGWDEPRKARERKYFENEGMDPEVSRAIREQESIAATRAQVQDQLEADRAEPEDDSA GT:EXON 1|1-482:0| BL:SWS:NREP 1 BL:SWS:REP 38->428|VG14_BPMD2|3e-42|32.0|381/485| SEG 188->202|ngwdidvvgddngid| RP:PFM:NREP 1 RP:PFM:REP 89->410|PF05133|4e-11|28.2|312/428|Phage_prot_Gp6| HM:PFM:NREP 1 HM:PFM:REP 19->445|PF05133|5.1e-74|25.4|413/442|Phage_prot_Gp6| OP:NHOMO 18 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ------------11-------------------1-211----------1---------------2----------11-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------11--1--1-----------------------------------------1------------------------------------ DISOP:02AL 437-450, 460-482| PSIPRED ccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHcccccHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHccccccHHHHHHHHHHHccEEEEEcccccccccEEEEEccccEEEEEEEcccccHHHHHEEEEcccccEEEEEEEccEEEEEEccccccEEEEccccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHcccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccEEEcccccccHHHHHHHHHHHHHccccccccccccHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHcccccccccccccc //