[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56371.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:179 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   49->109 PF08597 * eIF3_subunit 0.00053 26.2 61/245  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56371.1 GT:GENE BAD56371.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1683775..1684314 GB:FROM 1683775 GB:TO 1684314 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56371.1 LENGTH 179 SQ:AASEQ MTAPATGTPAPADPGTTEPTAPPVSTPNAEPATGTGDGDLGESGLAALKAERKARAAAEKAQAALEAKVKAFEDAQKTEAERTAERIAALEKDAAKALRYEAAEKAELPLSLAARLNGSTLEELIADAGQLKQLMGINAPDTPAPAPTPKPDRRQGGGETNAGGSMTAGRDLYRQRKRT GT:EXON 1|1-179:0| COIL:NAA 45 COIL:NSEG 1 COIL:REGION 40->84| SEG 2->23|tapatgtpapadpgtteptapp| SEG 45->71|laalkaerkaraaaekaqaaleakvka| SEG 78->91|teaertaeriaale| SEG 139->152|apdtpapaptpkpd| HM:PFM:NREP 1 HM:PFM:REP 49->109|PF08597|0.00053|26.2|61/245|eIF3_subunit| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-20, 51-76, 144-164, 176-179| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHcHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHccc //