[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56372.1
DDBJ      :             putative phage protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:122 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56372.1 GT:GENE BAD56372.1 GT:PRODUCT putative phage protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1684338..1684706 GB:FROM 1684338 GB:TO 1684706 GB:DIRECTION + GB:PRODUCT putative phage protein GB:PROTEIN_ID BAD56372.1 LENGTH 122 SQ:AASEQ MHLQLKTESFGQDDQSWLASGEGTERARSITLDMSTFAAGDYADGYLKSGWTLRKLASGLYGKRSNSDTEDIAGHLLTAVTVPSGVTKVGAALHWHGAVIAAKVPNPPDAAGQATAKQISYF GT:EXON 1|1-122:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------- DISOP:02AL 1-3| PSIPRED cEEEEEccccccccHHHHcccccccccEEEEEEccccccccccccHHHccccHHHHHcccccccccccHHHHHHHHHHHHHcccccccccccEEEccEEEEEEccccccccccHHHHHHccc //