[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56374.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.140.2
:92 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  54->88 1y02A1  a.140.2.1 * 6e-05 25.7 %
:HMM:PFM   54->83 PF10281 * Ish1 0.00033 26.7 30/38  
:BLT:SWISS 30->85 RL20_OENOB 8e-04 32.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56374.1 GT:GENE BAD56374.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1685747..1686025 GB:FROM 1685747 GB:TO 1686025 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56374.1 LENGTH 92 SQ:AASEQ MMARQLIAHVHVYDGDGRAHVFGPGDNVPDELAKRITNPAVWESNRDSDDDPSESWTVADLKAYAELHDIDLGEATKKADILAVIAQADDRS GT:EXON 1|1-92:0| BL:SWS:NREP 1 BL:SWS:REP 30->85|RL20_OENOB|8e-04|32.1|56/100| HM:PFM:NREP 1 HM:PFM:REP 54->83|PF10281|0.00033|26.7|30/38|Ish1| RP:SCP:NREP 1 RP:SCP:REP 54->88|1y02A1|6e-05|25.7|35/44|a.140.2.1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 43-52, 89-92| PSIPRED ccHHHEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccccccccccccccEEHHHHHHHHHHHccccccccccccEEEEEEcccccc //