[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56375.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   37->51 PF11643 * VASP 0.00017 57.1 14/30  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56375.1 GT:GENE BAD56375.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1686012..1686407 GB:FROM 1686012 GB:TO 1686407 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56375.1 LENGTH 131 SQ:AASEQ MTAPDPLSLFDIGDVQAIAGETFEEPETTQVKRFIDIAAAKLRTKVSRLDERISTGALDPVLVKGVGAEIVLRAVATLRRGIGVRRTEYPEISTEYEPATAGGLVQVTDDDIADLIDDAGSGDAFTIRVSA GT:EXON 1|1-131:0| SEG 109->124|dddiadliddagsgda| HM:PFM:NREP 1 HM:PFM:REP 37->51|PF11643|0.00017|57.1|14/30|VASP| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccccEEEcccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccEEEEccHHHHHHHHccccccEEEEEEEc //