[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56376.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:130 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   85->106 PF01336 * tRNA_anti 0.00059 36.4 22/76  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56376.1 GT:GENE BAD56376.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1686404..1686796 GB:FROM 1686404 GB:TO 1686796 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56376.1 LENGTH 130 SQ:AASEQ MTRLPERWTLLRDGEPTQDPLTGNRIDGPPIEVPWWGLLQKRSLTDLQVEEFEDGRASQRLILLLDPGLPGGTDRRDRWRFDGPASVADLVKVGDIVTVQGTPRNRRPARGSRRPAYIAAVVRHSSDLKE GT:EXON 1|1-130:0| SEG 61->72|lillldpglpgg| SEG 103->115|prnrrpargsrrp| HM:PFM:NREP 1 HM:PFM:REP 85->106|PF01336|0.00059|36.4|22/76|tRNA_anti| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 103-113, 126-130| PSIPRED cccccccEEEEEccccccccccccccccccccccHHHHHcccccccccHHHccccccccEEEEEEccccccccccccccccccccHHHHHHHcccEEEEEccccccccccccccccEEHHHHHHcccccc //