[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56378.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   36->96 PF04883 * DUF646 2.7e-06 35.6 59/106  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56378.1 GT:GENE BAD56378.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1686997..1687347 GB:FROM 1686997 GB:TO 1687347 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56378.1 LENGTH 116 SQ:AASEQ MAGNNFVGGGRARLEIFEAAVYSEARRGSTPSRIQMAEQAAAKARQLAPVVSGAYRDGVDVEVDGDQVFLVDNDPLAFIKEFGTVDTPAHAILTDAARELARYNDRGAFRAQTGLG GT:EXON 1|1-116:0| SEG 35->48|qmaeqaaakarqla| SEG 57->68|dgvdvevdgdqv| HM:PFM:NREP 1 HM:PFM:REP 36->96|PF04883|2.7e-06|35.6|59/106|DUF646| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-7, 27-40| PSIPRED ccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccEEEEEccccHHHHHHcccccccHHHHHHHHHHHHHHccccccEEEccccc //