[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56386.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->130 PF10910 * DUF2744 2e-18 45.9 %
:HMM:PFM   3->129 PF10910 * DUF2744 1.1e-51 56.2 121/125  
:BLT:SWISS 8->140 VG29_BPML5 9e-10 34.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56386.1 GT:GENE BAD56386.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1696572..1697156 GB:FROM 1696572 GB:TO 1697156 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56386.1 LENGTH 194 SQ:AASEQ MGKIWQLEDIDPDDPEQRFLPVLQYIPVGFGTDAGGRNRIVLPEALARAISKHLTECGVPPVDPAQAVKKLRAPYRGEQSPLNPLGDWVSIDEPEPPKVRLQDPAAMTPPERTALVEKLRYMGYRINEPLAPKPVAQVIDAIDDPPRFDPHTHSVTEVNAYLRDLDDEVEKRRVLYQEKRGQARRGILKRWEGA GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 8->140|VG29_BPML5|9e-10|34.4|125/147| RP:PFM:NREP 1 RP:PFM:REP 3->130|PF10910|2e-18|45.9|122/122|DUF2744| HM:PFM:NREP 1 HM:PFM:REP 3->129|PF10910|1.1e-51|56.2|121/125|DUF2744| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------1------------------------------------------------------------------------------------- DISOP:02AL 181-182, 184-185, 193-194| PSIPRED cccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccccccccccccccccccccccHHHccHHHHHHHHHHHHHcccEEccccccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccc //