[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56387.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:185 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56387.1 GT:GENE BAD56387.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1697156..1697713 GB:FROM 1697156 GB:TO 1697713 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56387.1 LENGTH 185 SQ:AASEQ MSFRTVYDYTHSENGWPMCDRDECVIADVPLEFIDTAPIRRGDAATILGAWMVWYDRNVEEIVSPVWGWSRENLVRNSNHLSGTAIDLNAPKYPWGRRVMARDLIDRVRAGLLLFEGCVFWGADWTRADEMHYQIGRLEGDPVLVSFAQRLRAGHLGIYGPPPPPEYSEFVRAGFAQLLPPSRRN GT:EXON 1|1-185:0| OP:NHOMO 9 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------------------------------------113---------1--------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------1--1---------------------------------------------------------------------------------- DISOP:02AL 182-185| PSIPRED ccEEEEEcccccccccccccHHHccEEccccccccccEEEcccHHHHHHHHHHHHccccEEEEccccccccccccccccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHccEEEEcccccccccccEEEcccccccHHHHHHHHHHHcEEEEEcccccccHHHHHHHHHHHHccccccc //