[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56389.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->69 PF04973 * NMN_transporter 0.00027 26.7 60/182  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56389.1 GT:GENE BAD56389.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1698642..1698887 GB:FROM 1698642 GB:TO 1698887 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56389.1 LENGTH 81 SQ:AASEQ MTSLNPLRYKPSQIAKALIAALTSIVGLLGLAASTFADGALATVGQWAIAAALFLAPILVFLKKAEPWIGMLDQLRGDARE GT:EXON 1|1-81:0| TM:NTM 2 TM:REGION 12->34| TM:REGION 41->62| SEG 48->62|aiaaalflapilvfl| HM:PFM:NREP 1 HM:PFM:REP 8->69|PF04973|0.00027|26.7|60/182|NMN_transporter| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 77-81| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccc //