Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56393.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:221 amino acids
:HMM:PFM   46->112 PF09916 * DUF2145 0.00039 29.0 62/201  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56393.1 GT:GENE BAD56393.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1699729..1700394 GB:FROM 1699729 GB:TO 1700394 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56393.1 LENGTH 221 SQ:AASEQ MTTPGGSPPDDDYAWEWGTDFGSTLDEDTILAISTNGAKTKFTGVQGAVGSEIREPAEHTRLIAVSAQGTADEAVTTAQAAANAAANAENLADAAYENSQEWSLEFVCASAEVLLGVNELLVGPMLNVRDGLNAILTDIHVALLEQHNGMTIQTRKWNAEGTAYTVAHEGSLGPNTTRRSFSALSVPVEDLERFFPYVTAVVGSVPPQVLQICVAGVYVPE GT:EXON 1|1-221:0| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 66->93| SEG 70->95|tadeavttaqaaanaaanaenladaa| SEG 112->123|evllgvnellvg| HM:PFM:NREP 1 HM:PFM:REP 46->112|PF09916|0.00039|29.0|62/201|DUF2145| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED ccccccccccccccEEccccccccccccEEEEEEccccEEEEccccccHHHHHHccHHHcEEEEEEcccccHHHHHHHHHHHHHHccHHHHHHHHHccccccEEEEEEEcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEcccccccccHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccc //