[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56400.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->49 PF04103 * CD20 0.00023 21.4 42/150  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56400.1 GT:GENE BAD56400.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1704146..1704505) GB:FROM 1704146 GB:TO 1704505 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56400.1 LENGTH 119 SQ:AASEQ MMTKPQLALMRSLTVAGAVALLVGVVLLVFDLANPQEVCSTSILGYESCHTSTSNRGAWIAGGAVLFLACTFVAWSTLSPSDAPVRKSGRGGSLRGLWIILGGLFVLVVVAATIDIATS GT:EXON 1|1-119:0| TM:NTM 3 TM:REGION 11->33| TM:REGION 60->81| TM:REGION 95->117| SEG 15->29|vagavallvgvvllv| SEG 88->110|sgrggslrglwiilgglfvlvvv| HM:PFM:NREP 1 HM:PFM:REP 8->49|PF04103|0.00023|21.4|42/150|CD20| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 82-91| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHcccccccccEEEHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccc //