[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56401.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   73->124 PF02787 * CPSase_L_D3 0.0001 25.5 51/121  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56401.1 GT:GENE BAD56401.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1704606..1704986) GB:FROM 1704606 GB:TO 1704986 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56401.1 LENGTH 126 SQ:AASEQ MMQIADLARQITDRTDIDYDAALTLATTYAVQCGYTDLPEGGQAPYAEVSAEDAGFILEAAGVAAEIEPPTLLDEIADAAAAIKTASARRDEAIRKAITNGVAVSKIAEAAELSRERVYQIRDRRR GT:EXON 1|1-126:0| SEG 15->30|tdidydaaltlattya| SEG 77->88|adaaaaiktasa| HM:PFM:NREP 1 HM:PFM:REP 73->124|PF02787|0.0001|25.5|51/121|CPSase_L_D3| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 124-126| PSIPRED ccHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccc //