[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56407.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:99 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  3->97 1wa8B1 a.25.3.1 * 6.7e-20 36.3 %
:RPS:PFM   7->88 PF06013 * WXG100 2e-06 29.6 %
:HMM:PFM   5->88 PF06013 * WXG100 4.4e-15 33.7 83/86  
:REPEAT 2|10->24|28->42

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56407.1 GT:GENE BAD56407.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1711119..1711418) GB:FROM 1711119 GB:TO 1711418 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56407.1 LENGTH 99 SQ:AASEQ MNSRFSVDLDHLEEIVARLSGLAGFIGEHLDEIDDRVATLTGTGWESVAARAYAEAHTQWAAAAREFVEGVRDMSDAAKAAHTRYTRAVDTNYKMFNGG GT:EXON 1|1-99:0| NREPEAT 1 REPEAT 2|10->24|28->42| RP:PFM:NREP 1 RP:PFM:REP 7->88|PF06013|2e-06|29.6|81/86|WXG100| HM:PFM:NREP 1 HM:PFM:REP 5->88|PF06013|4.4e-15|33.7|83/86|WXG100| HM:SCP:REP 3->97|1wa8B1|6.7e-20|36.3|91/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 7 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------6-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //