[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56408.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:112 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  11->105 1wa8B1 a.25.3.1 * 4.3e-15 31.9 %
:HMM:PFM   12->104 PF10824 * DUF2580 8.4e-17 26.9 93/100  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56408.1 GT:GENE BAD56408.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1711415..1711753) GB:FROM 1711415 GB:TO 1711753 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56408.1 LENGTH 112 SQ:AASEQ MSDGGTPASGPNLSVVPDEVWELGKYVYELADALRAALDSAAKDVASLTDGSWTGDAANEFSAGWTDVRDGGSQVMNALTGMAEKLGVTADTYRARDESNAASFNTSSLDLP GT:EXON 1|1-112:0| SEG 30->44|ladalraaldsaakd| HM:PFM:NREP 1 HM:PFM:REP 12->104|PF10824|8.4e-17|26.9|93/100|DUF2580| HM:SCP:REP 11->105|1wa8B1|4.3e-15|31.9|91/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 5 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------4-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //