[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56417.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y1571_NOCFA  RecName: Full=UPF0345 protein NFA_15710;

Homologs  Archaea  0/68 : Bacteria  209/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:103 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->101 3hqxA PDBj 8e-25 50.5 %
:RPS:SCOP  10->102 2oyzA1  b.82.1.22 * 2e-34 39.1 %
:RPS:PFM   11->102 PF06865 * DUF1255 5e-27 56.5 %
:HMM:PFM   11->102 PF06865 * DUF1255 1.4e-39 54.3 92/94  
:BLT:SWISS 1->103 Y1571_NOCFA 8e-58 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56417.1 GT:GENE BAD56417.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1723275..1723586 GB:FROM 1723275 GB:TO 1723586 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56417.1 LENGTH 103 SQ:AASEQ MSKFENVSVAKKANVYFDGACVSHSIEFPDGTAKSVGVILPATLTFGTTAPEVMELVEGHCRVTLPGADAPVTFRGGESFEVPADSEFTIEVLETVHYVCHYG GT:EXON 1|1-103:0| SW:ID Y1571_NOCFA SW:DE RecName: Full=UPF0345 protein NFA_15710; SW:GN OrderedLocusNames=NFA_15710; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->103|Y1571_NOCFA|8e-58|100.0|103/103| BL:PDB:NREP 1 BL:PDB:REP 2->101|3hqxA|8e-25|50.5|99/104| RP:PFM:NREP 1 RP:PFM:REP 11->102|PF06865|5e-27|56.5|92/94|DUF1255| HM:PFM:NREP 1 HM:PFM:REP 11->102|PF06865|1.4e-39|54.3|92/94|DUF1255| RP:SCP:NREP 1 RP:SCP:REP 10->102|2oyzA1|2e-34|39.1|92/93|b.82.1.22| OP:NHOMO 215 OP:NHOMOORG 213 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------1-----------1-----------------------------------1---------------------------------------------------------------------------------------------------------------------------------111111-----1111------1111111-11111-11111111-1111111-1----------111------1--------111111111--------2-------------------11--1----11111--1-111111111111-11-1--------1------1111111111111111--111111111111111111111111---111111111111111111111111--111111111111-------------111-----------------1111111112111111111111111-111---------1---111111-1111----------------1-111111-----------------------------------------------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1-----1----1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 97.1 SQ:SECSTR #ccccccEEccccEEETTTTEEEEEEEcTTccEEEEEEEccccEEEEccccE#EEEEEcEEEEEETTccccEEEETTcEEEEcTTcEEEEEccccEEEEEEc# DISOP:02AL 103-104| PSIPRED ccEEEEEEEEEEEEEEEccEEEEEEEEccccccccEEEEEEEEEEccccccEEEEEEccEEEEEEccccHHEEEccccEEEEccccEEEEEEcccHHEEEccc //