[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56420.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.272.1
:174 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:SCOP  99->130 1u2cA2  d.272.1.1 * 4e-04 40.6 %
:HMM:PFM   26->59 PF02337 * Gag_p10 0.00092 37.5 32/90  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56420.1 GT:GENE BAD56420.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1726028..1726552) GB:FROM 1726028 GB:TO 1726552 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56420.1 LENGTH 174 SQ:AASEQ MRIFPFRNRGAGPVDLRDVEQAVAALELPEAVFKTCPWQPRELVETGLRQWLRCCGAAMRDGQVIGMPSHAVDEAWHGLILCTERYAAFCDAAYGRFLHHYPDGSGSPTAAKHGTMTEQLGRTVVAWSLVAQPGETCVLWDLDRRVGVAHPWGIAAERVAAIEAELRRAAPNHS GT:EXON 1|1-174:0| SEG 155->170|aaervaaieaelrraa| HM:PFM:NREP 1 HM:PFM:REP 26->59|PF02337|0.00092|37.5|32/90|Gag_p10| RP:SCP:NREP 1 RP:SCP:REP 99->130|1u2cA2|4e-04|40.6|32/125|d.272.1.1| OP:NHOMO 12 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-----------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------------------1111-1------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 53.4 SQ:SECSTR #########ccccccHHHHHHHHHHHHTTccEEEEETTGGGGHHHHHHHHHHHHHT#ccGGGcEEEEEEccccccGGGccccHHHHHHHHHHHHHHHTcccEE####################################################################### DISOP:02AL 104-118, 170-174| PSIPRED ccccccccccccHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHcccccc //