[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56422.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   44->145 3cp3A PDBj 7e-05 11.1 %
:RPS:PFM   40->141 PF04075 * DUF385 2e-16 50.5 %
:HMM:PFM   11->143 PF04075 * DUF385 1.5e-39 46.5 129/132  
:BLT:SWISS 8->142 Y1292_MYCBO 3e-36 48.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56422.1 GT:GENE BAD56422.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1727312..1727749) GB:FROM 1727312 GB:TO 1727749 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56422.1 LENGTH 145 SQ:AASEQ MEMANLFVRALKAHQWIYEHSNGWVGHRLLLGNPTLLLYTVGRKTGEPRTSALTYARDGESYLVTASNGGSPRPPGWLANVKASPECAIQVGRRKLEVVARATYPDDPEYARRWALVDGVNRGRYSEYQRMTKRPIAVVVLTPTR GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 8->142|Y1292_MYCBO|3e-36|48.9|135/149| SEG 29->38|lllgnptlll| RP:PDB:NREP 1 RP:PDB:REP 44->145|3cp3A|7e-05|11.1|90/127| RP:PFM:NREP 1 RP:PFM:REP 40->141|PF04075|2e-16|50.5|99/130|DUF385| HM:PFM:NREP 1 HM:PFM:REP 11->143|PF04075|1.5e-39|46.5|129/132|DUF385| OP:NHOMO 102 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- --------------33433-34--3533333345553262-2-311--------------321-1-1-22---------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 64.8 SQ:SECSTR ##########################################cETTEEEEEEEEEEEEccccccEEEEEEccc###TcccTTcccEEEEEEcEEEEEEEEEEEEcccHHHHHHHT######cHTcccccccTTcccEEEEEEEEE DISOP:02AL 1-3| PSIPRED cccccHHHEEHHHHHEEEEEcccEEEEcccccccEEEEEEccccccccEEEEEEEEEEcccEEEEEccccccccccEEEEcccccEEEEEEccEEEEEEEEEEccccHHHHHHHHHHHHHccccHHHHHHHcccEEEEEEEEEcc //