[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56423.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:261 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   55->167 3ho1A PDBj 1e-04 34.9 %
:BLT:SWISS 27->133 GREA_PELCD 4e-04 32.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56423.1 GT:GENE BAD56423.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1728493..1729278 GB:FROM 1728493 GB:TO 1729278 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56423.1 LENGTH 261 SQ:AASEQ MSGQRVYRNPPIAMVAVEIRHSGTDTVTEEGYRAIRQQLRHQWPIELPAKDVAIEFEGTNPSPTVVEYRRYASRDLATAIVVRPGATTVETVDYKGWETLRQTLKAALDVRAAVSEPSGYVRVGLRYIDEVRVPGDGIAPDWSEWMHPSLLAAQPDDTAGLPLHDWHGLSAFKPADGHMVVLRYGPRTGYAVEPDGHLKRPSSPTGPFFLLDIDSFWEVTGSIPEFAPDELVTKCDNLHAPIRKLFEGLVTDKLRKEVFDA GT:EXON 1|1-261:0| BL:SWS:NREP 1 BL:SWS:REP 27->133|GREA_PELCD|4e-04|32.7|107/100| BL:PDB:NREP 1 BL:PDB:REP 55->167|3ho1A|1e-04|34.9|106/673| OP:NHOMO 18 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -----------------22-2---1-22222-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 41.4 SQ:SECSTR ######################################################cccccccccccHHHHHHHHHHHHHHHHHTTcccccEEEEEEEEEcccccEEc####ccccccGGGHHHHcccccccEEccccc#cccccHHHHHHHHHHHHcccccEEEEEcc############################################################################################## DISOP:02AL 1-8| PSIPRED cccccccccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHcccccHHHHEEEEcccccccccHHHEEEEEccccccEEEEEEccEEEEEEccccHHHHHHHHHHHHHHHHHHcccccEEEEHEEEEHHEEcccccccccHHHHHccHHcccccccccccHHHHEEEEEEEEEccccEEEEEEccccccEEcccccEEccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //