[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56424.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:274 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   146->166 PF08281 * Sigma70_r4_2 1.3e-05 42.9 21/54  
:HMM:PFM   4->119 PF01526 * Transposase_7 2.2e-05 14.8 115/968  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56424.1 GT:GENE BAD56424.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1729271..1730095 GB:FROM 1729271 GB:TO 1730095 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56424.1 LENGTH 274 SQ:AASEQ MPSSELARLKALDASKYIPFDSVLQTLQEWQATVGVTPEWEGRITTHRVRRSRAMAVRDHLKLLAELDQGSTASSLLVPPTGVSETTIDALVQTQDAYLERRHAQTKHTKAADDHRSKYLLEWQERAKLHSERAPVDMLSGLWHSGLSWRDIARLLKVSVAAVQKWRSGEKMSSKNFAHLRDFVAAYDTIAAHKPGVDIASWIDIPILTDVPVTPRDIWVKGDPKLFFEYALGDMKPETVLDAFDPDWRRRYRDDGFEAFVGTDGVLGIRTKDR GT:EXON 1|1-274:0| HM:PFM:NREP 2 HM:PFM:REP 146->166|PF08281|1.3e-05|42.9|21/54|Sigma70_r4_2| HM:PFM:REP 4->119|PF01526|2.2e-05|14.8|115/968|Transposase_7| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----------------11-1-----11111-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 104-114, 272-274| PSIPRED cccHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHccHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHcHHHccccccHHHHHHcccHHEEEEEEcccccHHHHHccccHHHHHHHHHHHHHHHHccccEEEEccccc //