[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56425.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:277 amino acids
:PSIPRED
:DISOPRED
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56425.1 GT:GENE BAD56425.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1730100..1730933 GB:FROM 1730100 GB:TO 1730933 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56425.1 LENGTH 277 SQ:AASEQ MATNEEESKWLHHGLETPPLADDGTIDWDRVWLYRNKSGVQQPRPVFTGDVYRDVPAVDDDKPSTVMILQHPCALLDKNNELRDVLLTAKVVDYKEVSAREWAGNFDVMPLVLATAKHQAVAFDQLALVRSSELELTKRVACMEIEGVACLLQRWVNVNTRVIVPCWRFITVIEAQFAEADGMQAWCEERRHARVKPVPAVKEATNWLDEKSPDTGVPRRELLKEPAFRKHIVRQMQEVARGRSQREIAERDRVKAERAQAEAEAATAVNREVVDKQ GT:EXON 1|1-277:0| COIL:NAA 26 COIL:NSEG 1 COIL:REGION 239->264| SEG 253->274|rvkaeraqaeaeaatavnrevv| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----------------11-1-----11111-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 231-263, 275-277| PSIPRED cccccHHHHHHHcccccccccccccccHHHEEEEHHHHccccccccEEcHHHccccccccccccEEEEEEccHHHHHcccccccEEEEEEccccccHHHHHHcccccccEEEEEccccHHHHHHHHHHHccccccHHHEEEEEcHHHHHHHHHHHHHcccEEEEEEEEEEEEEEcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //