[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56428.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:125 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->122 1bylA PDBj 2e-05 12.1 %
:RPS:SCOP  1->122 1bylA  d.32.1.2 * 5e-06 13.8 %
:HMM:SCOP  2->122 1xy7A_ d.32.1.9 * 1.4e-13 27.6 %
:HMM:PFM   13->52 PF00903 * Glyoxalase 0.00022 20.0 40/128  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56428.1 GT:GENE BAD56428.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1735022..1735399 GB:FROM 1735022 GB:TO 1735399 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56428.1 LENGTH 125 SQ:AASEQ MMTAEGVKGLRTVVLDCPEPRELAEFYRGLLGGEILEEESDRTWVALLDPQGRRLAFQLAPEYQPPTFPDPRASQQIHLDILVRDVEVAEPAVLALGAKFVQAAENFRVYTDPVGHTFCLVWLEE GT:EXON 1|1-125:0| SEG 29->39|gllggeileee| RP:PDB:NREP 1 RP:PDB:REP 1->122|1bylA|2e-05|12.1|116/122| HM:PFM:NREP 1 HM:PFM:REP 13->52|PF00903|0.00022|20.0|40/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->122|1bylA|5e-06|13.8|116/122|d.32.1.2| HM:SCP:REP 2->122|1xy7A_|1.4e-13|27.6|116/0|d.32.1.9|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 36 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ----1--------------------1----------11----111211-11-1-1--3---21-1-1252------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 95.2 SQ:SECSTR cc###ccccccccEEEEccHHHHHHHHHHTTccEEEEEccEcccEEEEEETTEEEEEEEcccTTTGGGcEEEEEEccHHHHHHHHHTTcccccccccccEEcccEEETTEEcTTccEEEEEE### DISOP:02AL 1-4| PSIPRED ccccHHEEEEEEEEEEcccHHHHHHHHHHHcccEEEcccccccEEEEccccccEEEEEccccccccccccccccEEEEEEEEEccHHHHHHHHHHcccEEccccccEEEEEcccccEEEEEEEcc //