[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56431.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->59 PF05938 * Self-incomp_S1 0.001 33.3 33/112  
:BLT:SWISS 3->63 HTXG_PSEST 8e-04 31.1 %
:BLT:SWISS 36->62 IAP4_NPVOP 2e-04 55.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56431.1 GT:GENE BAD56431.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1737432..1737662 GB:FROM 1737432 GB:TO 1737662 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56431.1 LENGTH 76 SQ:AASEQ MLPQTVSIKAPEMSAVLPSNTVEITTGPGDGVVVECVERDGRLRVHIVSPGYRREWNAQFPRGGFYRLRGDIRRLR GT:EXON 1|1-76:0| BL:SWS:NREP 2 BL:SWS:REP 3->63|HTXG_PSEST|8e-04|31.1|61/100| BL:SWS:REP 36->62|IAP4_NPVOP|2e-04|55.6|27/118| HM:PFM:NREP 1 HM:PFM:REP 27->59|PF05938|0.001|33.3|33/112|Self-incomp_S1| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------1-----------------------------------------------------------------------------1------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-7| PSIPRED ccccccccccccccccccccEEEEEccccccEEEEEEccccEEEEEEEccccccccEEEcccccEEEEEEEEEEcc //