[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56433.1
DDBJ      :             putative cytochrome d ubiquinol oxidase subunit II
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  237/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:346 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   51->182 PF02322 * Cyto_ox_2 3e-15 35.9 %
:HMM:PFM   4->325 PF02322 * Cyto_ox_2 4.5e-61 27.7 314/328  
:BLT:SWISS 51->167 CYDB_BACSU 5e-11 30.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56433.1 GT:GENE BAD56433.1 GT:PRODUCT putative cytochrome d ubiquinol oxidase subunit II GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1739214..1740254 GB:FROM 1739214 GB:TO 1740254 GB:DIRECTION + GB:PRODUCT putative cytochrome d ubiquinol oxidase subunit II GB:PROTEIN_ID BAD56433.1 LENGTH 346 SQ:AASEQ MMELSDVVASAMFAGVVAYALFAGADFGSGFWDLTAGGARRGGRLRVLIDHSIGPVWEANHVWLIYILVFLWTAYPGAFAAIMTTLFIPMSLALLGIVLRGANFAFRKYSATINQARLYGALFAGASLITPFFFGTVVGAVASGRVPADGYGDLVGSWVNPTSLIGGTLAVGTSAFLAGVFLTADAARSGDDALAAYLRPRTLVVGAVTGAFAIAAIAPIRRDAPTLGHELLGRALPLIVVSAAAGVLTLVLVYRGRFGWARVSALVAVAAIVLGWAVAQTPWILVDQLLIADAAGARSTLIGLLVVVALAGVTVLPALAYLFWLTQTDAWVREENSTDSDHARRD GT:EXON 1|1-346:0| BL:SWS:NREP 1 BL:SWS:REP 51->167|CYDB_BACSU|5e-11|30.2|116/338| TM:NTM 8 TM:REGION 3->25| TM:REGION 72->94| TM:REGION 123->145| TM:REGION 165->187| TM:REGION 201->220| TM:REGION 233->255| TM:REGION 267->289| TM:REGION 303->325| SEG 36->46|aggarrggrlr| SEG 204->226|vvgavtgafaiaaiapirrdapt| SEG 261->279|arvsalvavaaivlgwava| SEG 304->320|llvvvalagvtvlpala| RP:PFM:NREP 1 RP:PFM:REP 51->182|PF02322|3e-15|35.9|131/328|Cyto_ox_2| HM:PFM:NREP 1 HM:PFM:REP 4->325|PF02322|4.5e-61|27.7|314/328|Cyto_ox_2| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF02322|IPR003317| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02322|IPR003317| OP:NHOMO 288 OP:NHOMOORG 238 OP:PATTERN -----------------------------1-------------------------------------- 1---1----------------1---1----------1----111-----11-----1---------21-1------------------------------1--1-1-1-1111111111111111---------1---------1-111----1111-------11141----------------------1-111111111-111111--11-1111-------111111--------------------------22---------11---11--11---1--------------------------------------------------------------------2--1-------------------------------22--1-1-1-1---------------1-1---1-1----1--1-----11---11-11111--111111111--11--1------------11---111111111-1------1111-12221222111144112222-13311112--112-1----11-1-1---2-1-------------1--1-1-----------111------11111112---------------------------1--1111---1--------------------------------11-1-21------------------------------221----1----------------1---------1-------------------------1--2---------------------111--1--1-2221--1--1111--------------11111-1-----23233221-------------------------------------------------------------11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 333-346| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccEEcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //