[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56434.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  303/915 : Eukaryota  111/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:231 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->230 1u9cA PDBj 1e-27 36.5 %
:RPS:PDB   76->231 3b36A PDBj 1e-10 22.9 %
:RPS:SCOP  4->230 1izyA  c.23.16.2 * 1e-51 22.9 %
:HMM:SCOP  1->230 1qvzA_ c.23.16.2 * 1.2e-62 37.0 %
:RPS:PFM   77->229 PF01965 * DJ-1_PfpI 1e-09 40.9 %
:HMM:PFM   89->231 PF01965 * DJ-1_PfpI 4.3e-30 35.3 119/148  
:BLT:SWISS 74->230 HCHA_PSEAE 5e-17 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56434.1 GT:GENE BAD56434.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1740254..1740949 GB:FROM 1740254 GB:TO 1740949 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56434.1 LENGTH 231 SQ:AASEQ MAEILFVMSGADHWTLADGTKHPTGFWAEEFVAPYEVFTAAGHTVTVATPGGVVPSVDRGSLAPEVNGGPENAAKLAEAVRTAAPLQHPVPLAEVDPADYAAVFYPGGHGPMEDLPTDADSGRVLAQALSSGTPLGVVCHGPAALLATADADGNSPFAGYRLTAFSNAEEEQAGLAAKAPWLLADRLRELGVEYREGEPWAPHIEVDRTLYTGQNPASSRPLAEEIVRALG GT:EXON 1|1-231:0| BL:SWS:NREP 1 BL:SWS:REP 74->230|HCHA_PSEAE|5e-17|33.3|156/291| SEG 39->55|taaghtvtvatpggvvp| BL:PDB:NREP 1 BL:PDB:REP 7->230|1u9cA|1e-27|36.5|211/220| RP:PDB:NREP 1 RP:PDB:REP 76->231|3b36A|1e-10|22.9|131/187| RP:PFM:NREP 1 RP:PFM:REP 77->229|PF01965|1e-09|40.9|127/135|DJ-1_PfpI| HM:PFM:NREP 1 HM:PFM:REP 89->231|PF01965|4.3e-30|35.3|119/148|DJ-1_PfpI| RP:SCP:NREP 1 RP:SCP:REP 4->230|1izyA|1e-51|22.9|223/276|c.23.16.2| HM:SCP:REP 1->230|1qvzA_|1.2e-62|37.0|227/236|c.23.16.2|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 629 OP:NHOMOORG 422 OP:PATTERN ------------------------11111-11------------1----------------------- -11-2-------1-11--------------------1111-------1----21312---11-11-11-11---------1-------11-1-1--------1112-1-1------------------------------------11--11--------1-----1-11---------------1-----1--2222222--222222----1-22-11--123------11211111111111111311211-1-11-----11----11--------------------------------------------------------------------------------------------------------1--------1-11-----------11-11-11--11211-11-11--22-21-431231-----11-----1-11111111-3111--1--------------------------------2---11--3336241111122111111-131-112--------1--2--1---------11-------1-2---1---1-1------1-1-1-----------2---------------------------111--12131111-1111111---11-11123--------------212--11111111111-1111111111112-11111---11---------------------1-1111-----------------2----------2-11-----1---------4444512111--22124321131221111-1---11-1----1-1--1--1--23121221111111----11----------------------------------------------------- ----11--------2-12223323332111111---1---111111-114345422111111211-2-12--11-11111-111-122-241132-21211-1----14-4----11--1----21---151--12-1--1--31--------1-1-11--------------21-421J111-42---2-1111---2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 229 STR:RPRED 99.1 SQ:SECSTR ##EEEEEEEEccccEEETTccEEcTccHHHHHHHHHHHHHTTcEEEEEETTccccEEcTTccEEcccEEHHHEEccEEcTTccEEcccEEHHHHGGGccccEEEEcccHHHHHHHHHcHHHHHHHHHHHHTTcEEEEETTTTHHHHHTTccTccTTTTTcEEcccGGGHHHcTTcEEcccGGGHHHHTTTcccEEccccEcccEEEETTEEEEccGGGHHHHHHHHHHHHH PSIPRED ccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHccHHHccEEEEccccHHHHHHcccHHHHHHHHHHHHcccEEEEEEHHHHHHHHcccccccEEEcccEEEEEccHHHHHccccccccHHHHHHHHHcccEEEcccccccEEEEcccEEccccccHHHHHHHHHHHHHc //