[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56435.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:234 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   62->233 PF09203 * MspA 6e-08 36.8 %
:HMM:PFM   53->233 PF09203 * MspA 2.2e-58 49.7 157/175  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56435.1 GT:GENE BAD56435.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1741423..1742127 GB:FROM 1741423 GB:TO 1742127 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56435.1 LENGTH 234 SQ:AASEQ MDRFNLMRGSMSNNRTSGLRGGGRVVGIGAAATIAVGLFSTGAANADTFVPLPDGQKVGPGVTITRTGEHAVISPSMAANGAGRVAWVSGNATADVTVTPEGEVGPNNGPAGDPGTNNSSTHGASQLNTGYIVGCQVSIGDDAISAGLSGGIDLEGGSIGGSIGLDLGPGDVKFVQIDYKDITKPGVYSVEYQDVEIQIQGCAGYAQARSYTVVEIIGDHYSKTTLYGMPFSIG GT:EXON 1|1-234:0| SEG 18->38|glrgggrvvgigaaatiavgl| SEG 147->171|glsggidleggsiggsigldlgpgd| RP:PFM:NREP 1 RP:PFM:REP 62->233|PF09203|6e-08|36.8|152/175|MspA| HM:PFM:NREP 1 HM:PFM:REP 53->233|PF09203|2.2e-58|49.7|157/175|MspA| OP:NHOMO 14 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------5-27----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-7, 11-19| PSIPRED cccHHHHcccccccHHHHHccccEEEEHHHHHHHHHHHHHcccccccEEEEcccccEEcccEEEEEcccEEEEcccccccccccEEEEEEEEEEEEEEccccccccccccccccccccccccccccccccEEEEEEEEEccccEEccccccccccccEEEcEEEEEEccccEEEEEEEEEEccccccEEEEEEEEEEEEEEcccHHHcEEEEEEEEEcccEEEEEEEccccccc //