[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56436.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:229 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   52->228 PF09203 * MspA 3e-15 40.0 %
:HMM:PFM   51->228 PF09203 * MspA 2.7e-55 43.8 162/175  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56436.1 GT:GENE BAD56436.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1742184..1742873 GB:FROM 1742184 GB:TO 1742873 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56436.1 LENGTH 229 SQ:AASEQ MHRTMKIHKNTLRAAGACAAATVAFGMLSAGAANADTFVPLPGGEITKTLSDGTVVTVRLVGESATISPSMGATPVHRNAWVSGSAQVEISGGGEDVGGKIYPGYVVGCQVNIDGGGVEGGVEGSADWSGDTVTGGVGAESGGELTLGPGQAKSFYILDIEKPDDYGNEDHATNNKFKGNSGSVTWADSTIGLSGCAGYAQARSFVKVKVETDNVMSVVTLWGQPFSLG GT:EXON 1|1-229:0| SEG 14->24|aagacaaatva| SEG 115->124|gggveggveg| RP:PFM:NREP 1 RP:PFM:REP 52->228|PF09203|3e-15|40.0|160/175|MspA| HM:PFM:NREP 1 HM:PFM:REP 51->228|PF09203|2.7e-55|43.8|162/175|MspA| OP:NHOMO 13 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------5-17----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccEEEEEccccEEEHHHHHHHHHHHHHccccccccEEEEcccccEEEEcccccEEEEEEcccEEEEcccccccccccEEEEEEEEEEEEEccccccccEEEccEEEEEEEEEccccEEEEEccccccccccccccccccccccEEEccccEEEEEEEEEEccccEEcccccccccccccccEEEEEEEEEEEEEcccHHHEEEEEEEEEEcccEEEEEEEEcccEEcc //