[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56438.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   46->145 3bddB PDBj 4e-09 9.6 %
:RPS:SCOP  46->149 1lnwA  a.4.5.28 * 2e-08 17.3 %
:HMM:SCOP  14->149 2hr3A1 a.4.5.28 * 4.8e-15 26.5 %
:HMM:PFM   60->91 PF08279 * HTH_11 1.2e-06 38.7 31/55  
:BLT:SWISS 46->110 Y2911_MYCBO 1e-04 35.4 %
:BLT:SWISS 89->151 PURT_VARPS 3e-04 40.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56438.1 GT:GENE BAD56438.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1744327..1744791 GB:FROM 1744327 GB:TO 1744791 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56438.1 LENGTH 154 SQ:AASEQ MGETGAVTTENGRPEPPVTSASIVVLALARRVENELNAALADLDLTVRKLGLLGHVGRMPGVSFSELARMAGVSVQSVHTSVKALTAAGLVRDSTAKAGAASTIELTAAGSRLLAEARRVVGEVDERLFGAEADPVRRKLGAAIRHAFETGGIG GT:EXON 1|1-154:0| BL:SWS:NREP 2 BL:SWS:REP 46->110|Y2911_MYCBO|1e-04|35.4|65/139| BL:SWS:REP 89->151|PURT_VARPS|3e-04|40.3|62/100| SEG 33->45|enelnaaladldl| RP:PDB:NREP 1 RP:PDB:REP 46->145|3bddB|4e-09|9.6|94/131| HM:PFM:NREP 1 HM:PFM:REP 60->91|PF08279|1.2e-06|38.7|31/55|HTH_11| RP:SCP:NREP 1 RP:SCP:REP 46->149|1lnwA|2e-08|17.3|104/141|a.4.5.28| HM:SCP:REP 14->149|2hr3A1|4.8e-15|26.5|132/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 81.8 SQ:SECSTR ########################HccHHHHHHHHHccccEEccHcHHHHHHHHHHHHcccEEHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcccETEEEcEEEEcHHHHHHHTTcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHc#### DISOP:02AL 1-17, 152-154| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccc //