[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56442.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->94 PF04893 * Yip1 5.4e-05 20.3 79/173  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56442.1 GT:GENE BAD56442.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1747138..1747431 GB:FROM 1747138 GB:TO 1747431 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56442.1 LENGTH 97 SQ:AASEQ MSIILMSVGDTFSTLAQVGNPTPEAPPLSDKIMQFVRYATWFALLSGILSIVYAGGRFAWEKWSGNAMQSPKMVAGAMIGGVVATSAGTIMNAVIGA GT:EXON 1|1-97:0| TM:NTM 2 TM:REGION 38->60| TM:REGION 72->94| HM:PFM:NREP 1 HM:PFM:REP 5->94|PF04893|5.4e-05|20.3|79/173|Yip1| OP:NHOMO 5 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------41------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //