[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56445.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:272 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   83->142 PF07344 * Amastin 0.00053 13.6 59/155  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56445.1 GT:GENE BAD56445.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1750624..1751442) GB:FROM 1750624 GB:TO 1751442 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56445.1 LENGTH 272 SQ:AASEQ MSAPATRSAAVPGRTLAVLGALGALSVVAFVLAPAPVAARTAGGGFGDEAAVRAAFRAAFTGYWNSGSRDLPPDTAHLVEFWSHYHLVKALAAVAALIAFAATAVLVWQALARTGRHRAVLRTAGVLATALAAVAAVLTLANVQGALAPLASLLPMLVDEPADQALAGTLAQVRSALADAATAPPALAVMVEDFARYHRVLAVLAGGVAVALIGASIESGRRFAAGRHRPVTGTVAVSATAAALVATVVAVANTTNAADPAAGLAALFTGGW GT:EXON 1|1-272:0| TM:NTM 5 TM:REGION 14->36| TM:REGION 89->111| TM:REGION 129->151| TM:REGION 198->220| TM:REGION 240->262| SEG 16->39|lavlgalgalsvvafvlapapvaa| SEG 50->60|aavraafraaf| SEG 87->107|lvkalaavaaliafaatavlv| SEG 119->143|avlrtagvlatalaavaavltlanv| SEG 146->157|alaplasllpml| SEG 176->188|aladaatappala| SEG 200->215|vlavlaggvavaliga| SEG 231->266|vtgtvavsataaalvatvvavanttnaadpaaglaa| HM:PFM:NREP 1 HM:PFM:REP 83->142|PF07344|0.00053|13.6|59/155|Amastin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHcccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccc //