[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56446.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:165 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   70->132 PF04108 * APG17 3e-04 35.0 %
:HMM:PFM   72->151 PF06381 * DUF1073 1.2e-05 21.5 79/362  
:HMM:PFM   33->94 PF04043 * PMEI 0.001 23.3 60/151  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56446.1 GT:GENE BAD56446.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1751598..1752095 GB:FROM 1751598 GB:TO 1752095 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56446.1 LENGTH 165 SQ:AASEQ MSTPKGKGRDQTPRPGGPRVPGAAEILAAAQAAAAAAQTAAGQALESAQTTAGHAFDAAVRLPPASAQIAAQLPDLVENLSTAIDRLNSTIDRLDRTLALADPAFAAYDRLLPRLEAMIALGEDVLGALARLPGVAMLGKVTGFGRTGEGEAPPEPPKRRRRPSP GT:EXON 1|1-165:0| SEG 13->44|prpggprvpgaaeilaaaqaaaaaaqtaagqa| SEG 145->163|grtgegeappeppkrrrrp| RP:PFM:NREP 1 RP:PFM:REP 70->132|PF04108|3e-04|35.0|60/400|APG17| HM:PFM:NREP 2 HM:PFM:REP 72->151|PF06381|1.2e-05|21.5|79/362|DUF1073| HM:PFM:REP 33->94|PF04043|0.001|23.3|60/151|PMEI| GO:PFM:NREP 1 GO:PFM GO:0006914|"GO:autophagy"|PF04108|IPR007240| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------1-----------1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18, 147-165| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccHHHcccccc //