[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56449.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.213.1
:191 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  15->190 1rxqA_ a.213.1.1 * 2.9e-19 22.3 %
:HMM:PFM   37->190 PF11716 * MDMPI_N 4.4e-06 24.8 137/140  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56449.1 GT:GENE BAD56449.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1755373..1755948 GB:FROM 1755373 GB:TO 1755948 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56449.1 LENGTH 191 SQ:AASEQ MAIVPDVKDWTWVLERPCPECGYDGGKVGYDEVPVAARAAAARVRAALDRPDARRRPTESTWSPLEYAAHVRDVCRIFAFRIAVATGGPAADPHVPAFDPGEAAPAGAVPTFTNWDQDATAVADCYDRQDPAVVAAELTDAAERVAAAFAAVPPDARGRTARRADGALFTVDGLARYFLHDLVHHAHDVRG GT:EXON 1|1-191:0| SEG 33->57|vpvaaraaaarvraaldrpdarrrp| SEG 140->167|daaervaaafaavppdargrtarradga| HM:PFM:NREP 1 HM:PFM:REP 37->190|PF11716|4.4e-06|24.8|137/140|MDMPI_N| HM:SCP:REP 15->190|1rxqA_|2.9e-19|22.3|157/174|a.213.1.1|1/1|DinB/YfiT-like putative metalloenzymes| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----1---------1----------1-------1111111-----1--1---111-------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 190-191| PSIPRED ccccccccHHHHHHHcccHHHcccccccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccHHHHccEEccccHHHHHHHHHHHHHHHHHHHHHHHccc //